PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03905.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 354aa    MW: 37942.7 Da    PI: 5.2603
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03905.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161663148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WT+eEd +l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc03905.1.g00090.1.sm.mkhc 16 KGSWTPEEDMRLIAHIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                                    799*****************************99************97 PP

2Myb_DNA-binding50.93.5e-1669114148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rg +T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Zmw_sc03905.1.g00090.1.sm.mkhc  69 RGGFTAEEEETIIKLHGMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                                     788*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-24766IPR009057Homeodomain-like
PROSITE profilePS5129414.6441163IPR017930Myb domain
SuperFamilySSF466897.11E-3013110IPR009057Homeodomain-like
SMARTSM007175.6E-131565IPR001005SANT/Myb domain
PfamPF002491.4E-141663IPR001005SANT/Myb domain
CDDcd001674.32E-111863No hitNo description
PROSITE profilePS5129423.67664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2567117IPR009057Homeodomain-like
SMARTSM007176.1E-1468116IPR001005SANT/Myb domain
PfamPF002491.9E-1469114IPR001005SANT/Myb domain
CDDcd001673.54E-1172114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAH IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG GFTAEEEETI IKLHGMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRAAP  120
CGEQEHSAGG AKNKKQKPSV TEPTVPSPSP ASSSTTTTTN CSSGDSGEQQ SKGSKEELDL  180
KSLEIPMLDT TIFDLDVLMD PVPELYSCPS VPTSPCASST SPPAPAAGGV DDLLELPELD  240
IDQELWSIID GDGGGAVSFT EPSAMRHGHG NATEVNAATT SKGAGEGTEW WLENLERELG  300
LLGSMDDHQY LTGPLGLGHP DPLPAMAQLD PVSCYFQAGP TQAAAENCSN QMKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-291411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976660.11e-144PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-100MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK3Y8431e-144K3Y843_SETIT; Uncharacterized protein
STRINGSi010384m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798